PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008235662.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 284aa    MW: 32779.2 Da    PI: 6.0012
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008235662.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.43.4e-50101381129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF P+deelv++yL kk+++++     ++ e+d++ +ePw+Lp+ +k + +ewyfFs rd+kyatg r+nrat+sgyWkatgkd+ v++ 
  XP_008235662.1  10 LPPGFRFYPSDEELVCHYLLKKITNEEALK-GTLVEIDLHICEPWQLPEVAKLNANEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRMVMEP 103
                     79***********************99544.78***************88888999**************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +ge vg++ktLvfy++rap+g kt W+mhe+rle
  XP_008235662.1 104 gTGEIVGMRKTLVFYRNRAPNGIKTGWIMHEFRLE 138
                     88899***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-618156IPR003441NAC domain
PROSITE profilePS5100557.96410156IPR003441NAC domain
PfamPF023651.0E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLLK KITNEEALKG TLVEIDLHIC EPWQLPEVAK  60
LNANEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRMV MEPGTGEIVG MRKTLVFYRN  120
RAPNGIKTGW IMHEFRLETP HMPPKEDWVL CRVFHKGKGE ENTKLSPHDF MLETTSCTVP  180
LSMEKYSSPP TQDQTMPRGY NPIPSFSTPP PRHSHNQSNS LLNLLHFPQE KYSNNSVPEL  240
GAKNDDEYGF LWDMSLEETS FENGVAPDMD EMRFEMDHNS MVLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-47915616165NO APICAL MERISTEM PROTEIN
1ut4_B3e-47915616165NO APICAL MERISTEM PROTEIN
1ut7_A3e-47915616165NO APICAL MERISTEM PROTEIN
1ut7_B3e-47915616165NO APICAL MERISTEM PROTEIN
3swm_A3e-47915619168NAC domain-containing protein 19
3swm_B3e-47915619168NAC domain-containing protein 19
3swm_C3e-47915619168NAC domain-containing protein 19
3swm_D3e-47915619168NAC domain-containing protein 19
3swp_A3e-47915619168NAC domain-containing protein 19
3swp_B3e-47915619168NAC domain-containing protein 19
3swp_C3e-47915619168NAC domain-containing protein 19
3swp_D3e-47915619168NAC domain-containing protein 19
4dul_A3e-47915616165NAC domain-containing protein 19
4dul_B3e-47915616165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981220.0KF198122.1 Malus hupehensis NAC domain protein (NAC86) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008235662.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ84TE66e-65NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM5W1G40.0M5W1G4_PRUPE; Uncharacterized protein
STRINGGLYMA19G34881.11e-140(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43813359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.18e-94NAC domain containing protein 74